PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400067680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 148aa    MW: 16441.8 Da    PI: 8.5044
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400067680genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.71.9e-30356559
           ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                          +YkeClkNh a +GghavDGCgEfmps ge+gt++ +kCaAC+CHRnFHR+e+++
  PGSC0003DMP400067680  3 KYKECLKNHTAGIGGHAVDGCGEFMPS-GENGTVDVFKCAACNCHRNFHRKETVH 56
                          8*************************9.999*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-28354IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-20354IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-29353IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.856453IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.1E-10107146IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSKYKECLKN HTAGIGGHAV DGCGEFMPSG ENGTVDVFKC AACNCHRNFH RKETVHHHHP  60
CGYSPYIIPR QIPLALPLTS GGTGGGFRED QELLEMCSPN NNINGTLLKK RFRSKFSQEH  120
KDKMLTLAEK LGWKLQRHDE GVVQQIV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-84HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755173e-84HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015170277.11e-102PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotO647223e-42ZHD3_ARATH; Zinc-finger homeodomain protein 3
SwissprotQ9SB615e-43ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLM1DXI21e-108M1DXI2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000960051e-108(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-44homeobox protein 22
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]